PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154251001
Common NameGSBRNA2T00154251001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 155aa    MW: 17578.3 Da    PI: 8.9213
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154251001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF762.9e-24958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien  nr  tfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  GSBRNA2T00154251001  9 KRIENVNNRVLTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                         79*********************************************997 PP

2K-box73.27.3e-2571140170
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                          yqk sg++l++ak+e+l++e++k+kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R+++ 
  GSBRNA2T00154251001  71 YQKLSGNKLWDAKHENLSNEIDKIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAVEHGLDKVRDHQA 140
                          899***************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.66161IPR002100Transcription factor, MADS-box
SMARTSM004327.1E-36160IPR002100Transcription factor, MADS-box
CDDcd002651.07E-36280No hitNo description
SuperFamilySSF554552.88E-33296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-25323IPR002100Transcription factor, MADS-box
PfamPF003197.4E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-253859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-1582141IPR002487Transcription factor, K-box
PROSITE profilePS5129710.75584154IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGRGKIEIKR IENVNNRVLT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGNKLW DAKHENLSNE IDKIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAVEH GLDKVRDHQA HGVPYDKKEK CEHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S2e-15163163Myocyte-specific enhancer factor 2B
1tqe_R2e-15163163Myocyte-specific enhancer factor 2B
1tqe_Q2e-15163163Myocyte-specific enhancer factor 2B
1tqe_P2e-15163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.250981e-160flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154251001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679630.0KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013736393.11e-96PREDICTED: floral homeotic protein PISTILLATA-like isoform X2
RefseqXP_013736392.11e-96PREDICTED: floral homeotic protein PISTILLATA-like isoform X1
SwissprotP480073e-96PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A078DVL81e-110A0A078DVL8_BRANA; BnaA10g15180D protein
STRINGBra002285.1-P2e-96(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-97MIKC_MADS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]